Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi agn1 protein

This Fungi agn1 protein spans the amino acid sequence from region 21-424aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endo-1,3-alpha-glucanase agn1

UniProt

O13716

Expression Region

21-424aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

SchizosaccharoMyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DKMVVAHFIVGNTYPYTVSNWEEDIQDAIAVGIDGFALNMGSDAWQVERIEDAYDAAASVSSDFKLFISFDMSIISADADFIEGVVRRFADKPNQLYYDGKVFVSTFAGETDTFGYSDVSTGWDSAVKEPLASAGYPIYFVPSWTSLGQGALEESVADGFLSWNAWPTTDADMNDNDDIGYQNLANSLGKLYVAPVSPWFYTHLSYKNWAYKSDWLIIDRWNEMLSVQPDMIEVLTWNDYGESHYIGNIQGALPAGSEGYVDGFDHTAWRYLMSPYISAYKLGLSEPYINFESLFYWYRPTPKSATATADSLSYPSGGDYMEDEIFVLVYLLQSAEVTVTCGSTTQTFSGVPGVNQFTIPMETNASPSFTVARQGGTLASGTGPEIVDSLSIYNFNAYTGVLYF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Monkeypox Virus A35 Antibody (0017) [Alexa Fluor 488]
NBP3-18811AF488 0.1 mL

Mouse Monoclonal Monkeypox Virus A35 Antibody (0017) [Alexa Fluor 488]

Sign In for Pricing
View Details
RDH14 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E1]
TA502316BM 100 µL

RDH14 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E1]

Sign In for Pricing
View Details
PALD rabbit pAb
E44H13789 100 µL

PALD rabbit pAb

Sign In for Pricing
View Details
BOLA3 Protein Vector (Human) (pPM-C-His)
PV064852 500 ng

BOLA3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
EDG3 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-62974R-BF594 100 µL

EDG3 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal ZNF121 Antibody
NBP1-79350 100 µL

Rabbit Polyclonal ZNF121 Antibody

Sign In for Pricing
View Details