Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi agn1 protein

This Fungi agn1 protein spans the amino acid sequence from region 21-424aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Endo-1,3-alpha-glucanase agn1

UniProt

O13716

Expression Region

21-424aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

SchizosaccharoMyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DKMVVAHFIVGNTYPYTVSNWEEDIQDAIAVGIDGFALNMGSDAWQVERIEDAYDAAASVSSDFKLFISFDMSIISADADFIEGVVRRFADKPNQLYYDGKVFVSTFAGETDTFGYSDVSTGWDSAVKEPLASAGYPIYFVPSWTSLGQGALEESVADGFLSWNAWPTTDADMNDNDDIGYQNLANSLGKLYVAPVSPWFYTHLSYKNWAYKSDWLIIDRWNEMLSVQPDMIEVLTWNDYGESHYIGNIQGALPAGSEGYVDGFDHTAWRYLMSPYISAYKLGLSEPYINFESLFYWYRPTPKSATATADSLSYPSGGDYMEDEIFVLVYLLQSAEVTVTCGSTTQTFSGVPGVNQFTIPMETNASPSFTVARQGGTLASGTGPEIVDSLSIYNFNAYTGVLYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Hyaluronan synthase 1
E9712h 96 Tests

ELISA Kit For Hyaluronan synthase 1

Sign In for Pricing
View Details
Human 4-1BB Ligand Antibody
32660-05111 150 µg

Human 4-1BB Ligand Antibody

Sign In for Pricing
View Details
CCDC116 (NM_152612) Human Tagged ORF Clone
RG206731 10 µg

CCDC116 (NM_152612) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human Enolase 1 (ENO1)
RPU41284-01 50 µg

Recombinant Human Enolase 1 (ENO1)

Sign In for Pricing
View Details
Recombinant Human Enolase 1 (ENO1)
RPU41284-02 100 µg

Recombinant Human Enolase 1 (ENO1)

Sign In for Pricing
View Details
Recombinant Human Enolase 1 (ENO1)
RPU41284-03 1 mg

Recombinant Human Enolase 1 (ENO1)

Sign In for Pricing
View Details