Human PCBD1 protein
This Human PCBD1 protein spans the amino acid sequence from region 2-104aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
4-alpha-hydroxy-tetrahydropterin dehydratase Dimerization cofactor of hepatocyte nuclear factor 1-alpha
UniProt
P61457
Expression Region
2-104aa
Tag
N-terminal 6xHis-GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Epigenetics & Chromatin
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
41.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
041260 200 µL
Rps6kb1, CT (Rps6kb1, Ribosomal protein S6 kinase beta-1, 70kD ribosomal protein S6 kinase 1, Ribosomal protein S6 kinase I, p70 ribosomal S6 kinase alpha)
Sign In for Pricing
View Details 
MBS6265628-01 0.1 mL
Influenza A (H1N1, Flu A, Swine Flu, Flu A H1N11) (MaxLight 750)
Sign In for Pricing
View Details MBS6265628-02 5x 0.1 mL
Influenza A (H1N1, Flu A, Swine Flu, Flu A H1N11) (MaxLight 750)
Sign In for Pricing
View Details 