Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PCBD1 protein

This Human PCBD1 protein spans the amino acid sequence from region 2-104aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

4-alpha-hydroxy-tetrahydropterin dehydratase Dimerization cofactor of hepatocyte nuclear factor 1-alpha

UniProt

P61457

Expression Region

2-104aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PGLYRP3 shRNA (UAS) - Lentiviral human PGLYRP3 shRNA (UAS) (100)
GTR15086346 1 Vial

Lentiviral human PGLYRP3 shRNA (UAS) - Lentiviral human PGLYRP3 shRNA (UAS) (100)

Sign In for Pricing
View Details
AHCYL2 Rabbit Polyclonal Antibody
orb587052 100 µL

AHCYL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Krt9 qPCR Primer Pair
QM50314S 200 Tests

Mouse Krt9 qPCR Primer Pair

Sign In for Pricing
View Details
AGPAT2 Rabbit Polyclonal Antibody (Cy3)
orb2600371 100 µg

AGPAT2 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Glutathione Sepharose
6555-50 50 mL

Glutathione Sepharose

Sign In for Pricing
View Details
GSK-3484862
C01732-01 5 mg

GSK-3484862

Sign In for Pricing
View Details