Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PCBD1 protein

This Human PCBD1 protein spans the amino acid sequence from region 2-104aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

4-alpha-hydroxy-tetrahydropterin dehydratase Dimerization cofactor of hepatocyte nuclear factor 1-alpha

UniProt

P61457

Expression Region

2-104aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Ornithine Carbamoyl Transferase ELISA Kit
MBS729525-01 48 Well

Rat Ornithine Carbamoyl Transferase ELISA Kit

Sign In for Pricing
View Details
Rat Ornithine Carbamoyl Transferase ELISA Kit
MBS729525-02 96 Well

Rat Ornithine Carbamoyl Transferase ELISA Kit

Sign In for Pricing
View Details
Rat Ornithine Carbamoyl Transferase ELISA Kit
MBS729525-03 5x 96 Well

Rat Ornithine Carbamoyl Transferase ELISA Kit

Sign In for Pricing
View Details
Rat Ornithine Carbamoyl Transferase ELISA Kit
MBS729525-04 10x 96 Well

Rat Ornithine Carbamoyl Transferase ELISA Kit

Sign In for Pricing
View Details
Anti-CD23 Antibody-APC/Cy7 labled
MBS8321346-01 25 Assays

Anti-CD23 Antibody-APC/Cy7 labled

Sign In for Pricing
View Details
Anti-CD23 Antibody-APC/Cy7 labled
MBS8321346-02 100 Assays

Anti-CD23 Antibody-APC/Cy7 labled

Sign In for Pricing
View Details