Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Cry2 protein

This Rat Cry2 protein spans the amino acid sequence from region 1-594aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cry2Cryptochrome-2

UniProt

Q923I8

Expression Region

1-594aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

87.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAAAVVAATVPVQSMGADGASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPVGAVSSQHMENCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALVRLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYRKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAANCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLWASVPSCVEDLSHPVAEPGSSQAGSISNTGPRPLSSGPASPKRKLEAAEEPPGEELSKRARVTVTQMPAQEPPSKDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC mouse Ly-6G/Ly-6C Antibody
orb3065594-01 25 Tests

APC mouse Ly-6G/Ly-6C Antibody

Sign In for Pricing
View Details
APC mouse Ly-6G/Ly-6C Antibody
orb3065594-02 100 Tests

APC mouse Ly-6G/Ly-6C Antibody

Sign In for Pricing
View Details
RNF40 (Ring Finger Protein 40, BRE1B, RBP95, STARING) discontinued
219197-01 20 µL

RNF40 (Ring Finger Protein 40, BRE1B, RBP95, STARING) discontinued

Sign In for Pricing
View Details
RNF40 (Ring Finger Protein 40, BRE1B, RBP95, STARING) discontinued
219197-02 100 µL

RNF40 (Ring Finger Protein 40, BRE1B, RBP95, STARING) discontinued

Sign In for Pricing
View Details
PLCD3 Rabbit Polyclonal Antibody (FITC)
orb464544 100 µL

PLCD3 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Anti-Human UVRAG Polyclonal Antibody
ARO-A12916-01 50 µg

Anti-Human UVRAG Polyclonal Antibody

Sign In for Pricing
View Details