Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ITIH4 protein

This Human ITIH4 protein spans the amino acid sequence from region 689-930aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Inter-alpha-trypsin inhibitor family heavy chain-related protein

UniProt

Q14624

Expression Region

689-930aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics, Immunology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagenase Activity Colorimetric BioAssayTM Kit discontinued
301195 100 Tests

Collagenase Activity Colorimetric BioAssayTM Kit discontinued

Sign In for Pricing
View Details
FGF10, Recombinant, Human, aa38-208, His-Tag (Fibroblast growth factor 10, Keratinocyte growth factor 2)
351220-01 50 µg

FGF10, Recombinant, Human, aa38-208, His-Tag (Fibroblast growth factor 10, Keratinocyte growth factor 2)

Sign In for Pricing
View Details
FGF10, Recombinant, Human, aa38-208, His-Tag (Fibroblast growth factor 10, Keratinocyte growth factor 2)
351220-02 250 µg

FGF10, Recombinant, Human, aa38-208, His-Tag (Fibroblast growth factor 10, Keratinocyte growth factor 2)

Sign In for Pricing
View Details
Ism1 Mouse qPCR Primer Pair (NM_001126490)
MP222019 200 Reactions

Ism1 Mouse qPCR Primer Pair (NM_001126490)

Sign In for Pricing
View Details
Phospho-Src (Tyr418) Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-3426R-BF488 100 µL

Phospho-Src (Tyr418) Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
CRX Rabbit Polyclonal Antibody
orb2951379-01 50 µg

CRX Rabbit Polyclonal Antibody

Sign In for Pricing
View Details