Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reptile Pseudechis porphyriacus Basic phospholipase A2 pseudexin B chain protein

This Reptile Pseudechis porphyriacus Basic phospholipase A2 pseudexin B chain protein spans the amino acid sequence from region 1-117aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Phosphatidylcholine 2-acylhydrolase

UniProt

P20259

Expression Region

1-117aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Pseudechis porphyriacus (Red-bellied black snake)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NLIQFSNMIKCAIPGSRPLFQYADYGCYCGPGGHGTPVDELDRCCKIHDDCYGEAGKKGCFPKLTLYSWKCTEKVPTCNAKSRCKDFVCACDAEAAKCFAKAPYIKENYNINTKTRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Sterol carrier 2 Antibody
RC-16549-01 50 μL

Recombinant Sterol carrier 2 Antibody

Sign In for Pricing
View Details
Recombinant Sterol carrier 2 Antibody
RC-16549-02 100 µL

Recombinant Sterol carrier 2 Antibody

Sign In for Pricing
View Details
Recombinant Sterol carrier 2 Antibody
RC-16549-03 1 mL

Recombinant Sterol carrier 2 Antibody

Sign In for Pricing
View Details
ZCCHC17 Mouse Monoclonal Antibody [Clone ID: OTI9A7]
CF809551 100 µg

ZCCHC17 Mouse Monoclonal Antibody [Clone ID: OTI9A7]

Sign In for Pricing
View Details
Human ZNF808 activation kit by CRISPRa
GA117968 1 Kit

Human ZNF808 activation kit by CRISPRa

Sign In for Pricing
View Details
Human Lambda Light Chain Mouse Monoclonal Antibody [Clone ID: 1-155-2]
AM26140AC-N 100 Tests

Human Lambda Light Chain Mouse Monoclonal Antibody [Clone ID: 1-155-2]

Sign In for Pricing
View Details