Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus Non-structural protein 1 (NS) protein

This Virus Non-structural protein 1 (NS) protein spans the amino acid sequence from region 1-281aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NS1A

UniProt

P03502

Expression Region

1-281aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Influenza B virus (strain B/Lee/1940)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MADNMTTTQIEVGPGATNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIKTHNKSEPENKRMSLEERKAIGVKMMKVLLFMDPSAGIEGFEPYCVKNPSTSKCPNYDWTDYPPTPGKYLDDIEEEPENVDHPIEVVLRDMNNKDARQKIKDEVNTQKEGKFRLTIKRDIRNVLSLRVLVNGTFLKHPNGDKSLSTLHRLNAYDQNGGLVAKLVATDDRTVEDEKDGHRILNSLFERFDEGHSKPIRAAETAVGVLSQFGQEHRLSPEEGDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse ATP synthase protein 8 (Mtatp8), partial
MBS7055746-01 0.05 mg (E-Coli)

Recombinant Mouse ATP synthase protein 8 (Mtatp8), partial

Sign In for Pricing
View Details
Recombinant Mouse ATP synthase protein 8 (Mtatp8), partial
MBS7055746-02 0.2 mg (E-Coli)

Recombinant Mouse ATP synthase protein 8 (Mtatp8), partial

Sign In for Pricing
View Details
Recombinant Mouse ATP synthase protein 8 (Mtatp8), partial
MBS7055746-03 0.05 mg (Yeast)

Recombinant Mouse ATP synthase protein 8 (Mtatp8), partial

Sign In for Pricing
View Details
Recombinant Mouse ATP synthase protein 8 (Mtatp8), partial
MBS7055746-04 0.5 mg (E-Coli)

Recombinant Mouse ATP synthase protein 8 (Mtatp8), partial

Sign In for Pricing
View Details
Recombinant Mouse ATP synthase protein 8 (Mtatp8), partial
MBS7055746-05 0.2 mg (Yeast)

Recombinant Mouse ATP synthase protein 8 (Mtatp8), partial

Sign In for Pricing
View Details
Recombinant Mouse ATP synthase protein 8 (Mtatp8), partial
MBS7055746-06 0.05 mg (Baculovirus)

Recombinant Mouse ATP synthase protein 8 (Mtatp8), partial

Sign In for Pricing
View Details