Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Oxytocin protein

This Human Oxytocin protein spans the amino acid sequence from region 20-125aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ocytocin

UniProt

P01178

Expression Region

20-125aa

Tag

N-terminal 6xHis-sumostar-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MLH1 Mouse Monoclonal Antibody [Clone ID: OTI1B9]
CF805062 100 µg

MLH1 Mouse Monoclonal Antibody [Clone ID: OTI1B9]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Bovine IgG,  30nm
GAF-411-30 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Bovine IgG, 30nm

Sign In for Pricing
View Details
IFI16 Antibody
KC-27430-01 50 μL

IFI16 Antibody

Sign In for Pricing
View Details
IFI16 Antibody
KC-27430-02 100 µL

IFI16 Antibody

Sign In for Pricing
View Details
IFI16 Antibody
KC-27430-03 1 mL

IFI16 Antibody

Sign In for Pricing
View Details
Human/Mouse/Rat NF-L Recombinant Rabbit monoclonal Antibody
HA723335B 100 µL

Human/Mouse/Rat NF-L Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details