Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Oxytocin protein

This Human Oxytocin protein spans the amino acid sequence from region 20-125aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ocytocin

UniProt

P01178

Expression Region

20-125aa

Tag

Tag-Free

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Disperse Polyester Dark Blue, 90%
TRC-D493465-1MG 1 mg

Disperse Polyester Dark Blue, 90%

Sign In for Pricing
View Details
Calcein AM Assay Buffer
E-CK-A153 100 mL

Calcein AM Assay Buffer

Sign In for Pricing
View Details
Neopentyl Glycol Diglycidyl Ether (>40%)
TRC-N390018-5G 5 g

Neopentyl Glycol Diglycidyl Ether (>40%)

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2038), CF640R conjugate, 0.1mg/mL
BNC402038-100 1x 100 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2038), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human SPATA21 activation kit by CRISPRa
GA117796 1 Kit

Human SPATA21 activation kit by CRISPRa

Sign In for Pricing
View Details
Endothelin A Receptor (EDNRA) (NM_001166055) Human Over-expression Lysate
LC431279 20 µg

Endothelin A Receptor (EDNRA) (NM_001166055) Human Over-expression Lysate

Sign In for Pricing
View Details