Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Oxytocin protein

This Human Oxytocin protein spans the amino acid sequence from region 20-125aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ocytocin

UniProt

P01178

Expression Region

20-125aa

Tag

Tag-Free

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3046), CF405S conjugate, 0.1mg/mL
BNC043046-500 1x 500 µL

MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3046), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Adenosine Monophosphate Deaminase 3 (AMPD3) (AMPD3/901), CF405S conjugate, 0.1mg/mL
BNC040901-100 1x 100 µL

Adenosine Monophosphate Deaminase 3 (AMPD3) (AMPD3/901), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant DISC1 Antibody
RC-5241-01 50 μL

Recombinant DISC1 Antibody

Sign In for Pricing
View Details
Recombinant DISC1 Antibody
RC-5241-02 100 µL

Recombinant DISC1 Antibody

Sign In for Pricing
View Details
Recombinant DISC1 Antibody
RC-5241-03 1 mL

Recombinant DISC1 Antibody

Sign In for Pricing
View Details
Carfentanil Citrate
TRC-C183475-1MG 1 mg

Carfentanil Citrate

Sign In for Pricing
View Details