Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD244 protein

This Human CD244 protein spans the amino acid sequence from region 21-215aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NK cell activation-inducing ligand

UniProt

Q9BZW8

Expression Region

21-215aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cwc15 3'UTR Luciferase Stable Cell Line
TU202975 1.0 mL

Cwc15 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Separase Rabbit Polyclonal Antibody (APC)
orb993057 100 µL

Separase Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Clathrin Heavy Chain (Clathrin Heavy Chain 1, CLTC Hc, CHC17, Clathrin Heavy Polypeptide, CLH17, CLH-17, CLTCL2, Hc, KIAA0034) (HRP) discontinued
C5835-07D-HRP 100 µL

Clathrin Heavy Chain (Clathrin Heavy Chain 1, CLTC Hc, CHC17, Clathrin Heavy Polypeptide, CLH17, CLH-17, CLTCL2, Hc, KIAA0034) (HRP) discontinued

Sign In for Pricing
View Details
Human Crimean-Congo Hemorrhagic Fever Virus IgM (CCHFV- IgM) ELISA Kit
SL4793Hu-01 48 Tests

Human Crimean-Congo Hemorrhagic Fever Virus IgM (CCHFV- IgM) ELISA Kit

Sign In for Pricing
View Details
Human Crimean-Congo Hemorrhagic Fever Virus IgM (CCHFV- IgM) ELISA Kit
SL4793Hu-02 96 Tests

Human Crimean-Congo Hemorrhagic Fever Virus IgM (CCHFV- IgM) ELISA Kit

Sign In for Pricing
View Details
Human Transaldolase, TALDO1 ELISA Kit
MBS1609046-01 48 Well

Human Transaldolase, TALDO1 ELISA Kit

Sign In for Pricing
View Details