Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gallus IFN beta protein

This Gallus IFN beta protein spans the amino acid sequence from region 28-203aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFN2

UniProt

Q90873

Expression Region

28-203aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Gallus gallus (Chicken)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CNHLRHQDANFSWKSLQLLQNTAPPPPQPCPQQDVTFPFPETLLKSKDKKQAAITTLRILQHLFNMLSSPHTPKHWIDRTRHSLLNQIQHYIHHLEQCFVNQGTRSQRRGPRNAHLSINKYFRSIHNFLQHNNYSACTWDHVRLQARDCFRHVDTLIQWMKSRAPLTASSKRLNTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apolipoprotein A V (APOA5) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D1]
TA507164BM 100 µL

Apolipoprotein A V (APOA5) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D1]

Sign In for Pricing
View Details
PATL1, CT (PATL1, Protein PAT1 homolog 1, PAT1-like protein 1, Protein PAT1 homolog b) (FITC)
MBS6331091-01 0.2 mL

PATL1, CT (PATL1, Protein PAT1 homolog 1, PAT1-like protein 1, Protein PAT1 homolog b) (FITC)

Sign In for Pricing
View Details
PATL1, CT (PATL1, Protein PAT1 homolog 1, PAT1-like protein 1, Protein PAT1 homolog b) (FITC)
MBS6331091-02 5x 0.2 mL

PATL1, CT (PATL1, Protein PAT1 homolog 1, PAT1-like protein 1, Protein PAT1 homolog b) (FITC)

Sign In for Pricing
View Details
hCG beta antibody
10-C25C 1 mg

hCG beta antibody

Sign In for Pricing
View Details
Punt Polyclonal Antibody
MBS9237162-01 0.1 mL

Punt Polyclonal Antibody

Sign In for Pricing
View Details
Punt Polyclonal Antibody
MBS9237162-02 5x 0.1 mL

Punt Polyclonal Antibody

Sign In for Pricing
View Details