Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gallus IFN beta protein

This Gallus IFN beta protein spans the amino acid sequence from region 28-203aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFN2

UniProt

Q90873

Expression Region

28-203aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Gallus gallus (Chicken)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CNHLRHQDANFSWKSLQLLQNTAPPPPQPCPQQDVTFPFPETLLKSKDKKQAAITTLRILQHLFNMLSSPHTPKHWIDRTRHSLLNQIQHYIHHLEQCFVNQGTRSQRRGPRNAHLSINKYFRSIHNFLQHNNYSACTWDHVRLQARDCFRHVDTLIQWMKSRAPLTASSKRLNTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM125 sgRNA CRISPR Lentivector (Human) (Target 2)
K2397803 1.0 µg DNA

TMEM125 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
RPL23 Protein Lysate (Human) with C-Ha Tag
41130032 100 µg

RPL23 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Olr372 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV634455 1.0 µg DNA

Olr372 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Zfp687 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4891704 1.0 µg DNA

Zfp687 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
WDR5A Antibody
orb798617 2 mg

WDR5A Antibody

Sign In for Pricing
View Details
MEA1 Antibody
orb1269047 400 μl

MEA1 Antibody

Sign In for Pricing
View Details