Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus stxB protein

This Virus stxB protein spans the amino acid sequence from region 21-89aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Verocytotoxin 1 subunit B

UniProt

P69179

Expression Region

21-89aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Enterobacteria phage H19B (Bacteriophage H19B)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E2F8 3'UTR Luciferase Stable Cell Line
TU006509 1.0 mL

E2F8 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Ferroin Indicator Solution 100mL
DAI1138 1 Each

Ferroin Indicator Solution 100mL

Sign In for Pricing
View Details
COX5A (Cytochrome C Oxidase Subunit 5A, Mitochondrial, Cytochrome C Oxidase Polypeptide Va) (Biotin)
125254-Biotin 100 µL

COX5A (Cytochrome C Oxidase Subunit 5A, Mitochondrial, Cytochrome C Oxidase Polypeptide Va) (Biotin)

Sign In for Pricing
View Details
PHLPP1 Protein Vector (Rat) (pPM-C-His)
PV293845 500 ng

PHLPP1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Cyclopentyluracil
HY-130061 1 Each

Cyclopentyluracil

Sign In for Pricing
View Details
Recombinant Lysinibacillus sphaericus Glycine--tRNA ligase (glyQS)
MBS1251781-01 0.02 mg (E-Coli)

Recombinant Lysinibacillus sphaericus Glycine--tRNA ligase (glyQS)

Sign In for Pricing
View Details