Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus stxB protein

This Virus stxB protein spans the amino acid sequence from region 21-89aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Verocytotoxin 1 subunit B

UniProt

P69179

Expression Region

21-89aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Enterobacteria phage H19B (Bacteriophage H19B)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RABL4 Rabbit Polyclonal Antibody (FITC)
orb2114529 100 µL

RABL4 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Cyclin E1 Polyclonal Antibody
MBS9407965-01 0.05 mL

Cyclin E1 Polyclonal Antibody

Sign In for Pricing
View Details
Cyclin E1 Polyclonal Antibody
MBS9407965-02 0.1 mL

Cyclin E1 Polyclonal Antibody

Sign In for Pricing
View Details
Cyclin E1 Polyclonal Antibody
MBS9407965-03 5x 0.1 mL

Cyclin E1 Polyclonal Antibody

Sign In for Pricing
View Details
hsa-miR-892a miRNA Agomir
MBS8311339-01 5 nmol

hsa-miR-892a miRNA Agomir

Sign In for Pricing
View Details
hsa-miR-892a miRNA Agomir
MBS8311339-02 10 nmol

hsa-miR-892a miRNA Agomir

Sign In for Pricing
View Details