Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GLP2 protein

This Human GLP2 protein spans the amino acid sequence from region 53-89aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Incretin hormone

UniProt

P01275

Expression Region

53-89aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcein Orange Diacetate
orb1985064 1 mg

Calcein Orange Diacetate

Sign In for Pricing
View Details
Apolipoprotein E4 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2414129 100 µL

Apolipoprotein E4 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
IL18BP, Recombinant, Human (IL-18BP, Tadekinig-Alfa, Interleukin-18 Binding Protein) discontinued
500119 200 µg

IL18BP, Recombinant, Human (IL-18BP, Tadekinig-Alfa, Interleukin-18 Binding Protein) discontinued

Sign In for Pricing
View Details
Rat Cingulin (CGN) ELISA Kit
GTR10331012 96 Well

Rat Cingulin (CGN) ELISA Kit

Sign In for Pricing
View Details
HS1, phosphorylated (Tyr397) (Hematopoietic Specific Protein)
H7500-01 100 µL

HS1, phosphorylated (Tyr397) (Hematopoietic Specific Protein)

Sign In for Pricing
View Details
Lrrc8c sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3351308 1.0 µg DNA

Lrrc8c sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details