Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ang4 protein

This Mouse Ang4 protein spans the amino acid sequence from region 25-144aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ang4Angiogenin-4, EC 3.1.27.-

UniProt

Q3TMQ6

Expression Region

25-144aa

Tag

N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1130 Mouse shRNA Plasmid (Locus ID 258835)
TL511267 1 Kit

Olfr1130 Mouse shRNA Plasmid (Locus ID 258835)

Sign In for Pricing
View Details
Monkey Adipose Tissue Total RNA, Rhesus
UR-103 0.025 mg

Monkey Adipose Tissue Total RNA, Rhesus

Sign In for Pricing
View Details
XAB1, Recombinant, Human, aa1-374, His-Tag (XPA binding protein 1, GTPase)
350393-01 100 µg

XAB1, Recombinant, Human, aa1-374, His-Tag (XPA binding protein 1, GTPase)

Sign In for Pricing
View Details
XAB1, Recombinant, Human, aa1-374, His-Tag (XPA binding protein 1, GTPase)
350393-02 500 µg

XAB1, Recombinant, Human, aa1-374, His-Tag (XPA binding protein 1, GTPase)

Sign In for Pricing
View Details
Human PRXL2B Pre-designed siRNA Set A
SI012988A 1 Each

Human PRXL2B Pre-designed siRNA Set A

Sign In for Pricing
View Details
Olr1533 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV632050 1.0 µg DNA

Olr1533 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details