Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ang4 protein

This Mouse Ang4 protein spans the amino acid sequence from region 25-144aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ang4Angiogenin-4, EC 3.1.27.-

UniProt

Q3TMQ6

Expression Region

25-144aa

Tag

N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal NEK6 Antibody (OTI5D7) [HRP]
NBP2-72938H 0.1 mL

Mouse Monoclonal NEK6 Antibody (OTI5D7) [HRP]

Sign In for Pricing
View Details
Porcine Chymotrypsin inhibitor (CI) ELISA Kit
YP-W80703-01 48 Tests

Porcine Chymotrypsin inhibitor (CI) ELISA Kit

Sign In for Pricing
View Details
Porcine Chymotrypsin inhibitor (CI) ELISA Kit
YP-W80703-02 96 Tests

Porcine Chymotrypsin inhibitor (CI) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Bcl2l2 shRNA (UAS) - Lentiviral mouse Bcl2l2 shRNA (UAS, iRFP) (25)
GTR15150110 1 Vial

Lentiviral mouse Bcl2l2 shRNA (UAS) - Lentiviral mouse Bcl2l2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
AMPK alpha 2 (PRKAA2) (NM_006252) Human Tagged Lenti ORF Clone
RC210226L2 10 µg

AMPK alpha 2 (PRKAA2) (NM_006252) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rat Atp6v1g3 Pre-designed siRNA Set A
SI201181A 1 Each

Rat Atp6v1g3 Pre-designed siRNA Set A

Sign In for Pricing
View Details