Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria p37 protein

This Bacteria p37 protein spans the amino acid sequence from region 26-368aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P37, MG289, High affinity transport system protein p37

UniProt

Q49410

Expression Region

26-368aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CATKSDNTLIFNISLDHNADTSIEKFFTVFSKKLSGKLNKKINVNFNIVDDSFTKINNIQANKADFAFVNSQAIASNNWFGYTPLIQTLTTAFKEDLELDYYEDGNLQKKAEKTNLLFLSPPYKEWDDIKQKWTGNRYDFLYEPSKLVSFYRSMILITGSASEITAIKKAWNEKNWNQFMKFGIGHGQTNSASRFELPDLLFRKHFAKNYPGLQNAINSDPDKFAVVRGREIGINKNIKIVFDDANSFSWTQNIKGSKRPFYTPIDPNDRLEILTYSDPLLYDIGIVSNNLSRIYQKAIGEIFIELAQSSEDLYGPSIGYNGYKMINDFEKEVVEIIEKTYGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Von Willebrand Factor ELISA Kit
MBS8291393-01 96 Tests

Human Von Willebrand Factor ELISA Kit

Sign In for Pricing
View Details
Human Von Willebrand Factor ELISA Kit
MBS8291393-02 5x 96 Tests

Human Von Willebrand Factor ELISA Kit

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Ectonucleotide Pyrophosphatase/Phosphodiesterase 2 (ENPP2)
MBS2148302-01 0.1 mL

APC-Linked Monoclonal Antibody to Ectonucleotide Pyrophosphatase/Phosphodiesterase 2 (ENPP2)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Ectonucleotide Pyrophosphatase/Phosphodiesterase 2 (ENPP2)
MBS2148302-02 0.2 mL

APC-Linked Monoclonal Antibody to Ectonucleotide Pyrophosphatase/Phosphodiesterase 2 (ENPP2)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Ectonucleotide Pyrophosphatase/Phosphodiesterase 2 (ENPP2)
MBS2148302-03 0.5 mL

APC-Linked Monoclonal Antibody to Ectonucleotide Pyrophosphatase/Phosphodiesterase 2 (ENPP2)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Ectonucleotide Pyrophosphatase/Phosphodiesterase 2 (ENPP2)
MBS2148302-04 1 mL

APC-Linked Monoclonal Antibody to Ectonucleotide Pyrophosphatase/Phosphodiesterase 2 (ENPP2)

Sign In for Pricing
View Details