Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria p37 protein

This Bacteria p37 protein spans the amino acid sequence from region 26-368aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P37, MG289, High affinity transport system protein p37

UniProt

Q49410

Expression Region

26-368aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CATKSDNTLIFNISLDHNADTSIEKFFTVFSKKLSGKLNKKINVNFNIVDDSFTKINNIQANKADFAFVNSQAIASNNWFGYTPLIQTLTTAFKEDLELDYYEDGNLQKKAEKTNLLFLSPPYKEWDDIKQKWTGNRYDFLYEPSKLVSFYRSMILITGSASEITAIKKAWNEKNWNQFMKFGIGHGQTNSASRFELPDLLFRKHFAKNYPGLQNAINSDPDKFAVVRGREIGINKNIKIVFDDANSFSWTQNIKGSKRPFYTPIDPNDRLEILTYSDPLLYDIGIVSNNLSRIYQKAIGEIFIELAQSSEDLYGPSIGYNGYKMINDFEKEVVEIIEKTYGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MutY Antibody
orb822071 2 mg

MutY Antibody

Sign In for Pricing
View Details
CD8b (CD8 beta, CD8 Antigen beta Polypeptide 1, CD8B1, Leu2, Ly3, LYT3, MGC119115, T cell Surface Glycoprotein CD8 beta Chain) (MaxLight 405) discontinued
C2259-99D1-ML405 100 µL

CD8b (CD8 beta, CD8 Antigen beta Polypeptide 1, CD8B1, Leu2, Ly3, LYT3, MGC119115, T cell Surface Glycoprotein CD8 beta Chain) (MaxLight 405) discontinued

Sign In for Pricing
View Details
ZBED5 Protein Vector (Human) (pPM-C-His)
PV046828 500 ng

ZBED5 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
QPCR Kit DNA Human Papil Mmix
MOL8054 1 Each

QPCR Kit DNA Human Papil Mmix

Sign In for Pricing
View Details
ZNF682 Polyclonal Antibody
RA36614-01 50 µL

ZNF682 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF682 Polyclonal Antibody
RA36614-02 100 µL

ZNF682 Polyclonal Antibody

Sign In for Pricing
View Details