Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi ACT1 protein

This Fungi ACT1 protein spans the amino acid sequence from region 1-140aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ACT1Actin-1, Fragment

UniProt

P10982

Expression Region

1-140aa

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Absidia glauca (Pin mould)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSMEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREKMTQIMFETFNAPAFYVSIQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ferredoxin Reductase (FDXR) (NM_024417) Human Over-expression Lysate
LC402986 20 µg

Ferredoxin Reductase (FDXR) (NM_024417) Human Over-expression Lysate

Sign In for Pricing
View Details
TSG101 Recombinant Rabbit Monoclonal Antibody [JJ0900]
ET1701-59 100 µL

TSG101 Recombinant Rabbit Monoclonal Antibody [JJ0900]

Sign In for Pricing
View Details
CYTH3 Antibody
KC-26516-01 50 μL

CYTH3 Antibody

Sign In for Pricing
View Details
CYTH3 Antibody
KC-26516-02 100 µL

CYTH3 Antibody

Sign In for Pricing
View Details
CYTH3 Antibody
KC-26516-03 1 mL

CYTH3 Antibody

Sign In for Pricing
View Details
IL36G Mouse
OM296378-01 10 µg

IL36G Mouse

Sign In for Pricing
View Details