Fungi ACT1 protein
This Fungi ACT1 protein spans the amino acid sequence from region 1-140aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
ACT1Actin-1, Fragment
UniProt
P10982
Expression Region
1-140aa
Tag
N-terminal 6xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Absidia glauca (Pin mould)
Field of Research
Infectious Disease & Virology; Immunology & Inflammation
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
21.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Partial
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MSMEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREKMTQIMFETFNAPAFYVSIQA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC401550-100 1x 100 µL
Calpastatin (CAST/1550), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![MHC Class I H-2Ld Mouse Monoclonal Antibody [Clone ID: 30-5-7S]](https://cdn.genprice.uk/products/937/68dd18bc061270361e909318/imageurl/cl060pe.webp)
CL060PE 50 µg
MHC Class I H-2Ld Mouse Monoclonal Antibody [Clone ID: 30-5-7S]
Sign In for Pricing
View Details 
BNC403073-500 1x 500 µL
HPV16 E2 (Human Papilloma Virus 16) (TVG 261), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
AP52935PU-N 400 µL
GCNF (NR6A1) (N-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
LC403202 20 µg
GPR128 (ADGRG7) (NM_032787) Human Over-expression Lysate
Sign In for Pricing
View Details