Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi ACT1 protein

This Fungi ACT1 protein spans the amino acid sequence from region 1-140aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ACT1Actin-1, Fragment

UniProt

P10982

Expression Region

1-140aa

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Absidia glauca (Pin mould)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSMEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREKMTQIMFETFNAPAFYVSIQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cldn34c1 Mouse Gene Knockout Kit (CRISPR)
KN500310 1 Kit

Cldn34c1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Fluorescein Isothiocyanate (>85%)
TRC-F485715-1G 1 g

Fluorescein Isothiocyanate (>85%)

Sign In for Pricing
View Details
Mouse Atp10a activation kit by CRISPRa
GA200342 1 Kit

Mouse Atp10a activation kit by CRISPRa

Sign In for Pricing
View Details
Harmol
TRC-H105265-25MG 25 mg

Harmol

Sign In for Pricing
View Details
CD34 (QBEnd/10 + HPCA1/763), CF555 conjugate, 0.1mg/mL
BNC550904-100 1x 100 µL

CD34 (QBEnd/10 + HPCA1/763), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BOB1 (POU2AF1) Mouse Monoclonal Antibody [Clone ID: OTI3A5]
CF807990 100 µg

BOB1 (POU2AF1) Mouse Monoclonal Antibody [Clone ID: OTI3A5]

Sign In for Pricing
View Details