Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi ACT1 protein

This Fungi ACT1 protein spans the amino acid sequence from region 1-140aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ACT1Actin-1, Fragment

UniProt

P10982

Expression Region

1-140aa

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Absidia glauca (Pin mould)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSMEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREKMTQIMFETFNAPAFYVSIQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ileum
CS502416 5x 5 µm

Frozen Tissue Sections, Ileum

Sign In for Pricing
View Details
RYK Rabbit Polyclonal Antibody
AP14421PU-N 400 µL

RYK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ZNF681 activation kit by CRISPRa
GA115660 1 Kit

Human ZNF681 activation kit by CRISPRa

Sign In for Pricing
View Details
Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2000), CF640R conjugate, 0.1mg/mL
BNC402000-500 1x 500 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2000), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tex44 Mouse Gene Knockout Kit (CRISPR)
KN500108 1 Kit

Tex44 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ProPette™LiquiLock™ Premium Pipette Filter
P6080-PF 5 Units/Pack

ProPette™LiquiLock™ Premium Pipette Filter

Sign In for Pricing
View Details