Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Hmgcr protein

This Mouse Hmgcr protein spans the amino acid sequence from region 700-860aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hmgcr, 3-hydroxy-3-methylglutaryl-coenzyme A reductase, HMG-CoA reductase, EC 1.1.1.34

UniProt

Q01237

Expression Region

700-860aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GRGKTVVCEAVIPAKVVREVLKTTTEAMVDVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC23A2 CytoSection
TS416776P5 25 Slides

SLC23A2 CytoSection

Sign In for Pricing
View Details
Mouse IkBα (Inhibitory Subunit of NF Kappa B Alpha) ELISA Kit
EKE61735-01 96 Tests

Mouse IkBα (Inhibitory Subunit of NF Kappa B Alpha) ELISA Kit

Sign In for Pricing
View Details
Mouse IkBα (Inhibitory Subunit of NF Kappa B Alpha) ELISA Kit
EKE61735-02 5x 96 Tests

Mouse IkBα (Inhibitory Subunit of NF Kappa B Alpha) ELISA Kit

Sign In for Pricing
View Details
Hexafluoroglutaryl fluoride
sc-263377A 25 g

Hexafluoroglutaryl fluoride

Sign In for Pricing
View Details
Ubiquitin (Polyubiquitin B, RPS27A, UBA52, UBA80, UBC, UBCEP1, UBCEP2, Ubiquitin B, UBB)
U1000-06B-01 50 µg

Ubiquitin (Polyubiquitin B, RPS27A, UBA52, UBA80, UBC, UBCEP1, UBCEP2, Ubiquitin B, UBB)

Sign In for Pricing
View Details
Ubiquitin (Polyubiquitin B, RPS27A, UBA52, UBA80, UBC, UBCEP1, UBCEP2, Ubiquitin B, UBB)
U1000-06B-02 200 µg

Ubiquitin (Polyubiquitin B, RPS27A, UBA52, UBA80, UBC, UBCEP1, UBCEP2, Ubiquitin B, UBB)

Sign In for Pricing
View Details