Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Pparg protein

This Mouse Pparg protein spans the amino acid sequence from region 1-505aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nuclear receptor subfamily 1 group C member 3

UniProt

P37238

Expression Region

1-505aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

73.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig Taste Receptor Type 1 Member 3 ELISA Kit
MBS7258224-01 48 Well

Guinea Pig Taste Receptor Type 1 Member 3 ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Taste Receptor Type 1 Member 3 ELISA Kit
MBS7258224-02 96 Well

Guinea Pig Taste Receptor Type 1 Member 3 ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Taste Receptor Type 1 Member 3 ELISA Kit
MBS7258224-03 5x 96 Well

Guinea Pig Taste Receptor Type 1 Member 3 ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Taste Receptor Type 1 Member 3 ELISA Kit
MBS7258224-04 10x 96 Well

Guinea Pig Taste Receptor Type 1 Member 3 ELISA Kit

Sign In for Pricing
View Details
Caspase 3 Antibody, mAb, Rabbit
A02776-100 100 µL

Caspase 3 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Anti-Apoptosis inhibitor 5/API5 Antibody Picoband®, iFluor647 Conjugate
PA1009-iFluor647 100 µg

Anti-Apoptosis inhibitor 5/API5 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details