Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HLA-G protein

This Human HLA-G protein spans the amino acid sequence from region 25-308aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HLA G antigen MHC class I antigen G

UniProt

P17693

Expression Region

25-308aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bst2 (NM_198095) Mouse Tagged Lenti ORF Clone
MR201461L3 10 µg

Bst2 (NM_198095) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Synaptotagmin 1/2 (Ab-202/199)
336273 100 µL

Synaptotagmin 1/2 (Ab-202/199)

Sign In for Pricing
View Details
TCN2 Rabbit Polyclonal Antibody
orb512378 100 µg

TCN2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LPPR2 Rabbit Polyclonal Antibody (BF488)
orb2480984 100 µL

LPPR2 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Hepassocin Antibody
42-206 0.1 mg

Hepassocin Antibody

Sign In for Pricing
View Details
Flavokawain C
M20580-01 1 g

Flavokawain C

Sign In for Pricing
View Details