Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HLA-G protein

This Human HLA-G protein spans the amino acid sequence from region 25-308aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HLA G antigen MHC class I antigen G

UniProt

P17693

Expression Region

25-308aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal PIK3R4 Antibody (C-Terminus)
AMM07189G 0.05mg

Polyclonal PIK3R4 Antibody (C-Terminus)

Sign In for Pricing
View Details
Olfr1281 Mouse shRNA Plasmid (Locus ID 257979)
TL517276 1 Kit

Olfr1281 Mouse shRNA Plasmid (Locus ID 257979)

Sign In for Pricing
View Details
ACP1 Polyclonal Antibody
MBS9433384-01 0.05 mL

ACP1 Polyclonal Antibody

Sign In for Pricing
View Details
ACP1 Polyclonal Antibody
MBS9433384-02 0.1 mL

ACP1 Polyclonal Antibody

Sign In for Pricing
View Details
ACP1 Polyclonal Antibody
MBS9433384-03 5x 0.1 mL

ACP1 Polyclonal Antibody

Sign In for Pricing
View Details
RGL3 Rabbit Polyclonal Antibody (Fluoro594)
orb3095053 100 µg

RGL3 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details