Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF7 protein

This Human FGF7 protein spans the amino acid sequence from region 34-189aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Heparin-binding growth factor 7

UniProt

P21781

Expression Region

34-189aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHMT1P1 ORF Vector (Human) (pORF)
ORF032282 1.0 µg DNA

SHMT1P1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
PDCD6IP (AIP1, ALIX, KIAA1375, Programmed Cell Death 6-interacting Protein, ALG-2-interacting Protein 1, Hp95) (PE)
131039-PE 100 µL

PDCD6IP (AIP1, ALIX, KIAA1375, Programmed Cell Death 6-interacting Protein, ALG-2-interacting Protein 1, Hp95) (PE)

Sign In for Pricing
View Details
STRADB Antibody
CSB-PA874868EA01HU-01 50 µg

STRADB Antibody

Sign In for Pricing
View Details
STRADB Antibody
CSB-PA874868EA01HU-02 100 µg

STRADB Antibody

Sign In for Pricing
View Details
CSNK2A1 (Casein Kinase II Subunit alpha, CK II alpha, CK2A1) APC
MBS6374908-01 0.1 mL

CSNK2A1 (Casein Kinase II Subunit alpha, CK II alpha, CK2A1) APC

Sign In for Pricing
View Details
CSNK2A1 (Casein Kinase II Subunit alpha, CK II alpha, CK2A1) APC
MBS6374908-02 5x 0.1 mL

CSNK2A1 (Casein Kinase II Subunit alpha, CK II alpha, CK2A1) APC

Sign In for Pricing
View Details