Human SCGB2A2 protein
This Human SCGB2A2 protein spans the amino acid sequence from region 19-93aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Mammaglobin-1 (Secretoglobin family 2A member 2) (MGB1) (UGB2)
UniProt
Q13296
Expression Region
19-93aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Disease Biomarkers
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
37.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-UNEL-H0278-01 5x 96 Tests
Uncoated Human FGF23 (Fibroblast Growth Factor 23) ELISA Kit
Sign In for Pricing
View Details E-UNEL-H0278-02 15x 96 Tests
Uncoated Human FGF23 (Fibroblast Growth Factor 23) ELISA Kit
Sign In for Pricing
View Details 
BNC041686-100 1x 100 µL
VEGF (Vascular Endothelial Growth Factor) (VG1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682511-100 1x 100 µL
CD68 (Macrophage Marker) (C68/2511), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-BC-K030-S-01 50 Assays (48 samples)
Reduced Glutathione (GSH) Colorimetric Assay Kit
Sign In for Pricing
View Details