Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SCGB2A2 protein

This Human SCGB2A2 protein spans the amino acid sequence from region 19-93aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mammaglobin-1 (Secretoglobin family 2A member 2) (MGB1) (UGB2)

UniProt

Q13296

Expression Region

19-93aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Disease Biomarkers

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKLLMVLMLAALSQHCYAGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FIH (Factor inhibiting HIF1 (Hypoxia-inducible Factor), Hypoxia-inducible factor 1-alpha Inhibitor, Hypoxia-inducible Factor Asparagine Hydroxylase)
136778 100 µg

FIH (Factor inhibiting HIF1 (Hypoxia-inducible Factor), Hypoxia-inducible factor 1-alpha Inhibitor, Hypoxia-inducible Factor Asparagine Hydroxylase)

Sign In for Pricing
View Details
Txl1 Antibody
orb857706 2 mg

Txl1 Antibody

Sign In for Pricing
View Details
DLAT Antibody [N14J24]
C15882-100uL*2 2x 100μL

DLAT Antibody [N14J24]

Sign In for Pricing
View Details
Human SORBS3 Protein
orb428544-01 2 µg

Human SORBS3 Protein

Sign In for Pricing
View Details
Human SORBS3 Protein
orb428544-02 10 µg

Human SORBS3 Protein

Sign In for Pricing
View Details
Human SORBS3 Protein
orb428544-03 100 µg

Human SORBS3 Protein

Sign In for Pricing
View Details