Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL37 protein

This Human IL37 protein spans the amino acid sequence from region 1-218aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FIL1 zeta IL-1X Interleukin-1 family member 7

UniProt

Q9NZH6

Expression Region

1-218aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP1R3B Polyclonal Antibody
RD88052A-01 60 μL

PPP1R3B Polyclonal Antibody

Sign In for Pricing
View Details
PPP1R3B Polyclonal Antibody
RD88052A-02 120 μL

PPP1R3B Polyclonal Antibody

Sign In for Pricing
View Details
PPP1R3B Polyclonal Antibody
RD88052A-03 200 µL

PPP1R3B Polyclonal Antibody

Sign In for Pricing
View Details
Genesig® Easy kit for 2019-nCoV
Z-Path-2019-nCoV-EASY 50 Tests

Genesig® Easy kit for 2019-nCoV

Sign In for Pricing
View Details
PARP2 Immunizing Peptide
orb16780 100 µg

PARP2 Immunizing Peptide

Sign In for Pricing
View Details
TGM3/Transglutaminase 3, His, Human
Z05876-500 500 µg

TGM3/Transglutaminase 3, His, Human

Sign In for Pricing
View Details