Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL37 protein

This Human IL37 protein spans the amino acid sequence from region 1-218aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FIL1 zeta IL-1X Interleukin-1 family member 7

UniProt

Q9NZH6

Expression Region

1-218aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DISC1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-62128R-BF647-TR 20 µL

DISC1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
S100A13 Rabbit Polyclonal Antibody (APC)
orb1006468 100 µL

S100A13 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Cleaved-PARP1 Rabbit Monoclonal Antibody
AMRe01832-01 1 Each

Cleaved-PARP1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Cleaved-PARP1 Rabbit Monoclonal Antibody
AMRe01832-02 50 µL

Cleaved-PARP1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Cleaved-PARP1 Rabbit Monoclonal Antibody
AMRe01832-03 100 µL

Cleaved-PARP1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Borrelia Burgdorferi Antibody (FITC)
GWB-1C476B 1 mL

Borrelia Burgdorferi Antibody (FITC)

Sign In for Pricing
View Details