Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL37 protein

This Human IL37 protein spans the amino acid sequence from region 1-218aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FIL1 zeta IL-1X Interleukin-1 family member 7

UniProt

Q9NZH6

Expression Region

1-218aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

A530016L24Rik Protein Vector (Mouse) (pPM-C-HA)
PV150708 500 ng

A530016L24Rik Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Ras-Like protein family member 11A (RASL11A) Rat ELISA Kit
G6432 96 Tests

Ras-Like protein family member 11A (RASL11A) Rat ELISA Kit

Sign In for Pricing
View Details
DHRS2 Polyclonal Antibody, PE-Cy7 Conjugated
bs-10771R-PE-Cy7 100 µL

DHRS2 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Mouse Nubp1 Pre-designed siRNA Set A
SI109666A 1 Each

Mouse Nubp1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Mouse TPA (Tissue Polypeptide Antigen) ELISA Kit
MBS7607094-01 48 Well

Mouse TPA (Tissue Polypeptide Antigen) ELISA Kit

Sign In for Pricing
View Details
Mouse TPA (Tissue Polypeptide Antigen) ELISA Kit
MBS7607094-02 96 Well

Mouse TPA (Tissue Polypeptide Antigen) ELISA Kit

Sign In for Pricing
View Details