Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL37 protein

This Human IL37 protein spans the amino acid sequence from region 1-218aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FIL1 zeta IL-1X Interleukin-1 family member 7

UniProt

Q9NZH6

Expression Region

1-218aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCP2 Lentiviral Activation Particles (h)
sc-410133-LAC 200 µL

CCP2 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
1-ethyl-1H-pyrazol-4-amine
sc-333934 250 mg

1-ethyl-1H-pyrazol-4-amine

Sign In for Pricing
View Details
CHAC1 Antibody Fluoro647 Conjugated
orb3165783 100 µg

CHAC1 Antibody Fluoro647 Conjugated

Sign In for Pricing
View Details
Sialic Acid Binding Ig Like Lectin 1 (SIGLEC1) Human ELISA Kit
H0711 96 Tests

Sialic Acid Binding Ig Like Lectin 1 (SIGLEC1) Human ELISA Kit

Sign In for Pricing
View Details
PF-4778574 1mg
A21157-1 1 mg

PF-4778574 1mg

Sign In for Pricing
View Details
3- (3-Bromopropylcarbamoyl) benzeneboronic acid
OR3992 1 Each

3- (3-Bromopropylcarbamoyl) benzeneboronic acid

Sign In for Pricing
View Details