Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DEFB4A protein

This Human DEFB4A protein spans the amino acid sequence from region 1-64aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 2

UniProt

O15263

Expression Region

1-64aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC/CY7-Linked Polyclonal Antibody to Oxidosqualene Cyclase (OSC)
MBS2060392-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Oxidosqualene Cyclase (OSC)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Oxidosqualene Cyclase (OSC)
MBS2060392-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Oxidosqualene Cyclase (OSC)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Oxidosqualene Cyclase (OSC)
MBS2060392-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Oxidosqualene Cyclase (OSC)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Oxidosqualene Cyclase (OSC)
MBS2060392-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Oxidosqualene Cyclase (OSC)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Oxidosqualene Cyclase (OSC)
MBS2060392-05 5 mL

APC/CY7-Linked Polyclonal Antibody to Oxidosqualene Cyclase (OSC)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Oxidosqualene Cyclase (OSC)
MBS2060392-06 5x 5 mL

APC/CY7-Linked Polyclonal Antibody to Oxidosqualene Cyclase (OSC)

Sign In for Pricing
View Details