Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus gL protein

This Virus gL protein spans the amino acid sequence from region 31-278aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

F5HCH8

Expression Region

31-278aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAVSVAPTAAEKVPAECPELTRRCLLGEVFEGDKYESWLRPLVNVTGRDGPLSQLIRYRPVTPEAANSVLLDEAFLDTLALLYNNPDQLRALLTLLSSDTAPRWMTVMRGYSECGDGSPAVYTCVDDLCRGYDLTRLSYGRSIFTEHVLGFELVPPSLFNVVVAIRNEATRTNRAVRLPVSTAAAPEGITLFYGLYNAVKEFCLRHQLDPPLLRHLDKYYAGLPPELKQTRVNLPAHSRYGPQAVDAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM100B Protein Vector (Human) (pPB-C-His)
PV076521 500 ng

FAM100B Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
CD40 ligand, Recombinant, Mouse, aa112-260, His-Tag (CD40lg, CD154, CD40-L, Cd40l, Gp39, HIGM1, IGM, IMD3, Ly-62, Ly62, T-BAM, Tnfsf5, TRAP)
351142-01 10 µg

CD40 ligand, Recombinant, Mouse, aa112-260, His-Tag (CD40lg, CD154, CD40-L, Cd40l, Gp39, HIGM1, IGM, IMD3, Ly-62, Ly62, T-BAM, Tnfsf5, TRAP)

Sign In for Pricing
View Details
CD40 ligand, Recombinant, Mouse, aa112-260, His-Tag (CD40lg, CD154, CD40-L, Cd40l, Gp39, HIGM1, IGM, IMD3, Ly-62, Ly62, T-BAM, Tnfsf5, TRAP)
351142-02 50 µg

CD40 ligand, Recombinant, Mouse, aa112-260, His-Tag (CD40lg, CD154, CD40-L, Cd40l, Gp39, HIGM1, IGM, IMD3, Ly-62, Ly62, T-BAM, Tnfsf5, TRAP)

Sign In for Pricing
View Details
Przewaquinone A
TN2113-01 1 mg

Przewaquinone A

Sign In for Pricing
View Details
Przewaquinone A
TN2113-02 5 mg

Przewaquinone A

Sign In for Pricing
View Details
Przewaquinone A
TN2113-03 10 mg

Przewaquinone A

Sign In for Pricing
View Details