Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus nfuA protein

This Virus nfuA protein spans the amino acid sequence from region 1-194aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NfuA, VV1_0864, Fe/S biogenesis protein NfuA

UniProt

Q8DDU2

Expression Region

1-194aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Vibrio vulnificus (strain CMCP6)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NR2C2 Rabbit Polyclonal Antibody (Cy7)
orb1041031 100 µL

NR2C2 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Kalrn Rat shRNA Plasmid (Locus ID 84009)
TG711656 1 Kit

Kalrn Rat shRNA Plasmid (Locus ID 84009)

Sign In for Pricing
View Details
IL-32α Protein (N-Trx, Human)
P516222 100 µg

IL-32α Protein (N-Trx, Human)

Sign In for Pricing
View Details
Monoclonal Antibody to Fatty Acid Binding Protein 4 (FABP4)
MBS2138972-01 0.1 mL

Monoclonal Antibody to Fatty Acid Binding Protein 4 (FABP4)

Sign In for Pricing
View Details
Monoclonal Antibody to Fatty Acid Binding Protein 4 (FABP4)
MBS2138972-02 0.2 mL

Monoclonal Antibody to Fatty Acid Binding Protein 4 (FABP4)

Sign In for Pricing
View Details
Monoclonal Antibody to Fatty Acid Binding Protein 4 (FABP4)
MBS2138972-03 0.5 mL

Monoclonal Antibody to Fatty Acid Binding Protein 4 (FABP4)

Sign In for Pricing
View Details