Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EpCAM protein

This Human EpCAM protein spans the amino acid sequence from region 24-265aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adenocarcinoma-associated antigen Cell surface glycoprotein Trop-1 Epithelial cell surface antigen Epithelial glycoprotein Short name, EGP Epithelial glycoprotein 314 Short name, EGP314 Short name, hEGP314 KS 1/4 antigen KSA Major gastrointestinal tumor-associated protein GA733-2 Tumor-associated calcium signal transducer 1 CD_antigen, CD326

UniProt

P16422

Expression Region

24-265aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-KOX11 antibody
STJ93855 200 µl

Anti-KOX11 antibody

Sign In for Pricing
View Details
TRIAP1 Rabbit pAb
E45R27284N-50 50 µL

TRIAP1 Rabbit pAb

Sign In for Pricing
View Details
SSH2 (Protein Phosphatase Slingshot Homolog 2, SSH-like Protein 2, SSH2L, SSH-2L, hSSH-2L, KIAA1725) (MaxLight 405) discontinued
133863-ML405 100 µL

SSH2 (Protein Phosphatase Slingshot Homolog 2, SSH-like Protein 2, SSH2L, SSH-2L, hSSH-2L, KIAA1725) (MaxLight 405) discontinued

Sign In for Pricing
View Details
RNF210 Rabbit pAb
E47R8494 100 µL

RNF210 Rabbit pAb

Sign In for Pricing
View Details
Human TSPAN14 qPCR Primer Pair
QH54117S 200 Tests

Human TSPAN14 qPCR Primer Pair

Sign In for Pricing
View Details
Rabbit Polyclonal ECSCR Antibody
NBP2-68807-25ul 25 µL

Rabbit Polyclonal ECSCR Antibody

Sign In for Pricing
View Details