Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EpCAM protein

This Human EpCAM protein spans the amino acid sequence from region 24-265aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adenocarcinoma-associated antigen Cell surface glycoprotein Trop-1 Epithelial cell surface antigen Epithelial glycoprotein Short name, EGP Epithelial glycoprotein 314 Short name, EGP314 Short name, hEGP314 KS 1/4 antigen KSA Major gastrointestinal tumor-associated protein GA733-2 Tumor-associated calcium signal transducer 1 CD_antigen, CD326

UniProt

P16422

Expression Region

24-265aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DBCO-?C6-?acid
MBS5768938 Inquire

DBCO-?C6-?acid

Sign In for Pricing
View Details
SUMO1 Recombinant Antibody, Cy5 Conjugated
bsm-61144R-Cy5-01 20 µL

SUMO1 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
SUMO1 Recombinant Antibody, Cy5 Conjugated
bsm-61144R-Cy5-02 100 µL

SUMO1 Recombinant Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Guinea pig Papillomavirus 16 (E7) (HPV16/E7) ELISA Kit
EIA07235Gu 1 Kit

Guinea pig Papillomavirus 16 (E7) (HPV16/E7) ELISA Kit

Sign In for Pricing
View Details
NFκB p65 Mouse Monoclonal Antibody
AG3101 50 µL

NFκB p65 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
KCNIP2 (Kv Channel-interacting Protein 2, KChIP2, A-type Potassium Channel Modulatory Protein 2, Cardiac Voltage-gated Potassium Channel Modulatory Subunit, Potassium Channel-interacting Protein 2, DKFZp566L1246, MGC17241) APC
MBS6137268-01 0.1 mL

KCNIP2 (Kv Channel-interacting Protein 2, KChIP2, A-type Potassium Channel Modulatory Protein 2, Cardiac Voltage-gated Potassium Channel Modulatory Subunit, Potassium Channel-interacting Protein 2, DKFZp566L1246, MGC17241) APC

Sign In for Pricing
View Details