Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EpCAM protein

This Human EpCAM protein spans the amino acid sequence from region 24-265aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adenocarcinoma-associated antigen Cell surface glycoprotein Trop-1 Epithelial cell surface antigen Epithelial glycoprotein Short name, EGP Epithelial glycoprotein 314 Short name, EGP314 Short name, hEGP314 KS 1/4 antigen KSA Major gastrointestinal tumor-associated protein GA733-2 Tumor-associated calcium signal transducer 1 CD_antigen, CD326

UniProt

P16422

Expression Region

24-265aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGLUR5 Polyclonal Antibody, Cy3 Conjugated
bs-18801R-Cy3 100 µL

MGLUR5 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
FCGR2C Antibody
A21750-50UL 50 μL

FCGR2C Antibody

Sign In for Pricing
View Details
FCP1 (3G4) : m-IgG Fc BP-HRP Bundle
sc-552000 1 Kit

FCP1 (3G4) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Recombinant Mouse Centromere protein C 1 (Cenpc1) , partial
MBS717494 Inquire

Recombinant Mouse Centromere protein C 1 (Cenpc1) , partial

Sign In for Pricing
View Details
CNTROB Antibody
MBS8582850-01 0.1 mL

CNTROB Antibody

Sign In for Pricing
View Details
CNTROB Antibody
MBS8582850-02 0.1 mL (AF635)

CNTROB Antibody

Sign In for Pricing
View Details