Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CXCL1 protein

This Human CXCL1 protein spans the amino acid sequence from region 35-107aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C-X-C motif chemokine 1 GRO-alpha (1-73) Melanoma growth stimulatory activity Short name, MGSA Neutrophil-activating protein 3 Short name, NAP-3

UniProt

P09341

Expression Region

35-107aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human RNF150 sgRNA gene knockout kit - Lentiviral human RNF150 sgRNA gene knockout kit (plasmid)
GTR15398414 1 Vial

Lentiviral human RNF150 sgRNA gene knockout kit - Lentiviral human RNF150 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
KLRG2 Protein Vector (Mouse) (pPM-C-HA)
PV195064 500 ng

KLRG2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
FBXW10 Rabbit Polyclonal Antibody
orb183660-01 50 μL

FBXW10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FBXW10 Rabbit Polyclonal Antibody
orb183660-02 100 µL

FBXW10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FBXW10 Rabbit Polyclonal Antibody
orb183660-03 200 µL

FBXW10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ARD1B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0111908 1.0 µg DNA

ARD1B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details