Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Cr2 protein

This Mouse Cr2 protein spans the amino acid sequence from region 12-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Complement C3d receptor CD_antigen, CD21

UniProt

P19070

Expression Region

12-145aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSYRLIGEKAIFCISENQVHATWDKAPPICESVNKTISCSDPIVPGGFMNKGSKAPFRHGDSVTFTCKANFTMKGSKTVWCQANEMWGPTALPVCESDFPLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAA1 Biosimilar Antibody
orb2669617-01 50 µg

SAA1 Biosimilar Antibody

Sign In for Pricing
View Details
SAA1 Biosimilar Antibody
orb2669617-02 100 µg

SAA1 Biosimilar Antibody

Sign In for Pricing
View Details
GENLISA Rat B-Cell Lymphoma / Leukemia 10 (BCL10) ELISA
KLR2663 1x 96 Well

GENLISA Rat B-Cell Lymphoma / Leukemia 10 (BCL10) ELISA

Sign In for Pricing
View Details
Compound TN12754
orb3179145-01 1 mg

Compound TN12754

Sign In for Pricing
View Details
Compound TN12754
orb3179145-02 2 mg

Compound TN12754

Sign In for Pricing
View Details
Compound TN12754
orb3179145-03 3 mg

Compound TN12754

Sign In for Pricing
View Details