Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus mip protein

This Virus mip protein spans the amino acid sequence from region 21-233aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Macrophage infectivity potentiator Peptidyl-prolyl cis-trans isomerase Short name, PPIase

UniProt

A5IGB8

Expression Region

21-233aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Legionella pneumophila (strain Corby)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATDATSLATDKDKLSYSIGADLGKNFKNQGIDVNPEAMAKGMQDAMSGAQLALTEQQMKDVLNKFQKDLMAKRTAEFNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINAGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

UTL-5g
C09409-25mg 25 mg

UTL-5g

Sign In for Pricing
View Details
Zmym5 3'UTR Lenti-reporter-Luc Vector
51280084 1.0 µg

Zmym5 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
SMCR3 Protein Vector (Human) (pPM-C-HA)
PV130396 500 ng

SMCR3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
CBLL1 antibody
70R-8000 100 µL

CBLL1 antibody

Sign In for Pricing
View Details
MRPS12 3'UTR GFP Stable Cell Line
TU064612 1.0 mL

MRPS12 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Zfp934 shRNA (UAS) - Lentiviral mouse Zfp934 shRNA (UAS, iRFP) (25)
GTR15196274 1 Vial

Lentiviral mouse Zfp934 shRNA (UAS) - Lentiviral mouse Zfp934 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details