Virus mip protein
This Virus mip protein spans the amino acid sequence from region 21-233aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Macrophage infectivity potentiator Peptidyl-prolyl cis-trans isomerase Short name, PPIase
UniProt
A5IGB8
Expression Region
21-233aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Legionella pneumophila (strain Corby)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
24.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
ATDATSLATDKDKLSYSIGADLGKNFKNQGIDVNPEAMAKGMQDAMSGAQLALTEQQMKDVLNKFQKDLMAKRTAEFNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINAGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
11259062 1.0 µg DNA
ACTL6A Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 
abx105625-01 20 µg
Lipopolysaccharide-Responsive And Beige-Like Anchor Protein (LRBA) Antibody (Biotin)
Sign In for Pricing
View Details abx105625-02 50 µg
Lipopolysaccharide-Responsive And Beige-Like Anchor Protein (LRBA) Antibody (Biotin)
Sign In for Pricing
View Details 
abx105625-03 100 µg
Lipopolysaccharide-Responsive And Beige-Like Anchor Protein (LRBA) Antibody (Biotin)
Sign In for Pricing
View Details 
abx105625-04 200 µg
Lipopolysaccharide-Responsive And Beige-Like Anchor Protein (LRBA) Antibody (Biotin)
Sign In for Pricing
View Details abx105625-05 1 mg
Lipopolysaccharide-Responsive And Beige-Like Anchor Protein (LRBA) Antibody (Biotin)
Sign In for Pricing
View Details