Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus mip protein

This Virus mip protein spans the amino acid sequence from region 21-233aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Macrophage infectivity potentiator Peptidyl-prolyl cis-trans isomerase Short name, PPIase

UniProt

A5IGB8

Expression Region

21-233aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Legionella pneumophila (strain Corby)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATDATSLATDKDKLSYSIGADLGKNFKNQGIDVNPEAMAKGMQDAMSGAQLALTEQQMKDVLNKFQKDLMAKRTAEFNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINAGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal HRASLS2 Antibody [Alexa Fluor 350]
NBP3-06348AF350 0.1 mL

Rabbit Polyclonal HRASLS2 Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
Mouse Monoclonal INSM2 Antibody (INSM2/4291) [Alexa Fluor 405]
NBP3-08530AF405 100 µL

Mouse Monoclonal INSM2 Antibody (INSM2/4291) [Alexa Fluor 405]

Sign In for Pricing
View Details
ANKRD20A1 Lentiviral Activation Particles (h)
sc-416957-LAC 200 µL

ANKRD20A1 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Mouse Glypican-4 ELISA Kit
MBS2886334-01 48 Well

Mouse Glypican-4 ELISA Kit

Sign In for Pricing
View Details
Mouse Glypican-4 ELISA Kit
MBS2886334-02 96 Well

Mouse Glypican-4 ELISA Kit

Sign In for Pricing
View Details
Mouse Glypican-4 ELISA Kit
MBS2886334-03 5x 96 Well

Mouse Glypican-4 ELISA Kit

Sign In for Pricing
View Details