Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Serpina3n protein

This Mouse Serpina3n protein spans the amino acid sequence from region 21-418aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Serpina3n, Spi2, Serine protease inhibitor A3N, Serpin A3N

UniProt

Q91WP6

Expression Region

21-418aa (ins21S, Δ315S)

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics, Immunology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SFPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

520 A 1/2 Folded Filters 240mm
10331451 100 / PCK

520 A 1/2 Folded Filters 240mm

Sign In for Pricing
View Details
CXCL9/MIG (E7X3P) Rabbit Monoclonal Antibody
CST 93556S 100 µL

CXCL9/MIG (E7X3P) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Pnisr Protein Vector (Human) (pPM-C-HA)
37091021 500 ng

Pnisr Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
C9ORF46 (PLGRKT) Human Gene Knockout Kit (CRISPR)
KN202315RB 1 Kit

C9ORF46 (PLGRKT) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
p16INK4A (CDKN2A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4H4]
TA809880BM 100 µL

p16INK4A (CDKN2A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4H4]

Sign In for Pricing
View Details
CBLN2 (Cerebellin-2) (AP)
MBS6409721-01 0.1 mL

CBLN2 (Cerebellin-2) (AP)

Sign In for Pricing
View Details