Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Serpina3n protein

This Mouse Serpina3n protein spans the amino acid sequence from region 21-418aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Serpina3n, Spi2, Serine protease inhibitor A3N, Serpin A3N

UniProt

Q91WP6

Expression Region

21-418aa (ins21S, Δ315S)

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics, Immunology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SFPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAPSS2 Antibody, FITC conjugated
CSB-PA527262LC01HU-01 50 µg

PAPSS2 Antibody, FITC conjugated

Sign In for Pricing
View Details
PAPSS2 Antibody, FITC conjugated
CSB-PA527262LC01HU-02 100 µg

PAPSS2 Antibody, FITC conjugated

Sign In for Pricing
View Details
SMAD2 (SMAD Family Member 2, JV18, JV18-1, MADH2, MADR2, MGC22139, MGC34440, hMAD-2, hSMAD2) (PE)
251785-PE 100 µL

SMAD2 (SMAD Family Member 2, JV18, JV18-1, MADH2, MADR2, MGC22139, MGC34440, hMAD-2, hSMAD2) (PE)

Sign In for Pricing
View Details
GRK5 Rabbit Polyclonal Antibody (Biotin)
orb446436 100 µL

GRK5 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Cathepsin A Protein, Mouse, Recombinant (His)
TMPY-01450-01 5 µg

Cathepsin A Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details
Cathepsin A Protein, Mouse, Recombinant (His)
TMPY-01450-02 10 µg

Cathepsin A Protein, Mouse, Recombinant (His)

Sign In for Pricing
View Details